settings Currency keyboard_arrow_down
EURAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemail
shopping_cart Basket (0)
location_on
Oi-Lin ® Eye Cream
Oi-Lin ® Eye Cream

Oi-Lin ® Eye Cream

Product Code:  42020
Product Description
Oi-Lin ® Eye Cream 14 g

Oi-Lin ® Eye Cream is a complete, concentrated herbal eye care product that provides moisture, reduces puffiness and dark circles and makes the skin supple. This fast acting formula offers the very latest in skin care technology

Use:
Apply the cream in the morning and evening with a light tapping movement in the eye area. After that, use Dr. Chen ® Refining and Firming Cream and Oi-Lin ® Replenish Gel. Keep the product in the dark to keep the ingredients effective.
59,10 € inc. tax
Add to Cart Quantity
Product Details
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Description
No Reviews Posted Yet - be the first! write review
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i